PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.340790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 224aa    MW: 25833 Da    PI: 8.4794
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.340790.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.88.8e-123465132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEd++l+++++ +G ++Wk+Ia++ g
   Cucsa.340790.1 34 KGAWTAEEDQKLAQVIAIHGAKRWKSIAAKAG 65
                     79***************************998 PP

2Myb_DNA-binding50.54.7e-16115160148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
   Cucsa.340790.1 115 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 160
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.37529109IPR017930Myb domain
SuperFamilySSF466896.32E-83065IPR009057Homeodomain-like
SMARTSM007172.9E-1333111IPR001005SANT/Myb domain
PfamPF002493.8E-103465IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2335116IPR009057Homeodomain-like
CDDcd001674.99E-836109No hitNo description
SuperFamilySSF466898.13E-2195168IPR009057Homeodomain-like
PROSITE profilePS5129425.186110164IPR017930Myb domain
SMARTSM007171.9E-15114162IPR001005SANT/Myb domain
PfamPF002492.0E-14115160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-25117165IPR009057Homeodomain-like
CDDcd001675.92E-10119160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MTEEEEESLK RKVKQVVEGD INEAEILRNG GVNKGAWTAE EDQKLAQVIA IHGAKRWKSI  60
AAKAGPSLST FNFSFFFPTS HAHIFNGFLN FPGLNRCGKS CRLRWLNYLR PNIKRGNISD  120
QEEDLILRLH KLLGNRWSLI AGRLPGRTDN EIKNYWNSHL SKKMNQQSEK ERRKGCKRKV  180
NTESREEETS QERENSSNLE YDVDNLFDFS NEGPDLEWMS NFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-252916422128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818280.0LN681828.1 Cucumis melo genomic scaffold, anchoredscaffold00083.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011652333.11e-165PREDICTED: transcription factor WER-like isoform X1
TrEMBLA0A061GJK05e-78A0A061GJK0_THECC; Myb domain protein 23
STRINGPOPTR_0003s06320.11e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.18e-47myb domain protein 66